PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100082580141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 316aa    MW: 35170.1 Da    PI: 5.9163
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100082580141genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-3282135154
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                                   kprlrWt +LH+rFv+av+qLGG+ekAtPkti+++m+vkgLtl+h+kSHLQkY 
  Ote100082580141|100082580141  82 KPRLRWTADLHDRFVDAVTQLGGPEKATPKTIMRTMGVKGLTLYHLKSHLQKYW 135
                                   79***************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.32179139IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-3080136IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-2382136IPR006447Myb domain, plants
SuperFamilySSF466891.31E-1582136IPR009057Homeodomain-like
PfamPF002491.7E-784134IPR001005SANT/Myb domain
PfamPF143796.3E-19171225IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDQIRTATDE DDWTRLXXXX XXXXXXXXXX XXXXXXXXDR RIRLEGWRIN AAVEAGGLDY  60
QGSLDGTYLP GDACLLLSSD PKPRLRWTAD LHDRFVDAVT QLGGPEKATP KTIMRTMGVK  120
GLTLYHLKSH LQKYWLGNLA SSKELTETSK DGSSTSASLK TMAQDINDGY QVTEALRVQM  180
EVQRRLHEQL ECFLCNPHQV QQHPQIRIEA QSKYLQSILD KACKALDDQA VACAGLEAAR  240
KELSELAIKV ANDCNGILSV RSLSHNDSDM DKNSIPYLPA RLGECSIDND VMSNGSLDSQ  300
AAALKXXXXX KAAAFI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091431.11e-124PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK54e-55APL_ARATH; Myb family transcription factor APL
TrEMBLA0A068TU041e-111A0A068TU04_COFCA; Uncharacterized protein
STRINGVIT_05s0029g00060.t018e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344